Lineage for d3zr4a_ (3zr4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826664Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 2826665Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)
  7. 2826678Species Thermotoga maritima [TaxId:2336] [51371] (12 PDB entries)
  8. 2826696Domain d3zr4a_: 3zr4 A: [192811]
    Other proteins in same PDB: d3zr4b_, d3zr4d_, d3zr4f_
    automated match to d1thfd_
    complexed with gln, gol

Details for d3zr4a_

PDB Entry: 3zr4 (more details), 2.41 Å

PDB Description: structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex
PDB Compounds: (A:) Imidazole glycerol phosphate synthase subunit hisF

SCOPe Domain Sequences for d3zr4a_:

Sequence, based on SEQRES records: (download)

>d3zr4a_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mlakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrlegl

Sequence, based on observed residues (ATOM records): (download)

>d3zr4a_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mlakriiacldvkdgrvvgdpvelgkfyseigidelvflditasvekrktmlelvekvae
qidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfgsqavvvaida
krvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksgydtemirfvr
plttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeylkkhgvnvrle
gl

SCOPe Domain Coordinates for d3zr4a_:

Click to download the PDB-style file with coordinates for d3zr4a_.
(The format of our PDB-style files is described here.)

Timeline for d3zr4a_: