Lineage for d2xv6d_ (2xv6 D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758808Species Vicugna pacos [TaxId:30538] [189756] (9 PDB entries)
  8. 1758815Domain d2xv6d_: 2xv6 D: [192801]
    Other proteins in same PDB: d2xv6a_, d2xv6c_
    automated match to d1ieha_

Details for d2xv6d_

PDB Entry: 2xv6 (more details), 1.89 Å

PDB Description: crystal structure of the hiv-1 capsid protein c-terminal domain (146- 220) in complex with a camelid vhh.
PDB Compounds: (D:) camelid vhh 9

SCOPe Domain Sequences for d2xv6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xv6d_ b.1.1.1 (D:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstvy
ddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss

SCOPe Domain Coordinates for d2xv6d_:

Click to download the PDB-style file with coordinates for d2xv6d_.
(The format of our PDB-style files is described here.)

Timeline for d2xv6d_: