![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (18 species) not a true protein |
![]() | Species Vicugna pacos [TaxId:30538] [189756] (9 PDB entries) |
![]() | Domain d2xv6d_: 2xv6 D: [192801] Other proteins in same PDB: d2xv6a_, d2xv6c_ automated match to d1ieha_ |
PDB Entry: 2xv6 (more details), 1.89 Å
SCOPe Domain Sequences for d2xv6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xv6d_ b.1.1.1 (D:) automated matches {Vicugna pacos [TaxId: 30538]} qvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstvy ddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss
Timeline for d2xv6d_: