SCOPe 2.08: Domain d2xv6d1: 2xv6 D:1-112

Lineage for d2xv6d1 (2xv6 D:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d2xv6d1: 2xv6 D:1-112 [192801]
   Other proteins in same PDB: d2xv6a_, d2xv6b2, d2xv6c_, d2xv6d2
   automated match to d1ieha_

Details for d2xv6d1

PDB Entry: 2xv6, 1.89 Å

PDB Description: crystal structure of the hiv-1 capsid protein c-terminal domain (146- 220) in complex with a camelid vhh.

PDB Compounds: (D:) camelid vhh 9

SCOPe Domain Sequences for d2xv6d1:

Sequence; same for both SEQRES and ATOM records:

>d2xv6d1 b.1.1.1 (D:1-112) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstvy
ddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvs

Timeline for d2xv6d1:

• d2xv6d1 first appeared in SCOPe 2.02, called d2xv6d_
  
• d2xv6d1 appears in SCOPe 2.07