Lineage for d2xv6d1 (2xv6 D:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745477Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)
  8. 2745524Domain d2xv6d1: 2xv6 D:1-112 [192801]
    Other proteins in same PDB: d2xv6a_, d2xv6b2, d2xv6c_, d2xv6d2
    automated match to d1ieha_

Details for d2xv6d1

PDB Entry: 2xv6 (more details), 1.89 Å

PDB Description: crystal structure of the hiv-1 capsid protein c-terminal domain (146- 220) in complex with a camelid vhh.
PDB Compounds: (D:) camelid vhh 9

SCOPe Domain Sequences for d2xv6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xv6d1 b.1.1.1 (D:1-112) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstvy
ddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvs

SCOPe Domain Coordinates for d2xv6d1:

Click to download the PDB-style file with coordinates for d2xv6d1.
(The format of our PDB-style files is described here.)

Timeline for d2xv6d1: