SCOPe 2.06: Domain d3pbub_: 3pbu B:

Lineage for d3pbub_ (3pbu B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein automated matches [190130] (11 species)
   not a true protein

7. Species Methanobacterium thermoautotrophicum [TaxId:187420] [189749] (5 PDB entries)

8. Domain d3pbub_: 3pbu B: [192799]
   automated match to d2czea_
   complexed with up6; mutant

Details for d3pbub_

PDB Entry: 3pbu, 1.3 Å

PDB Description: crystal structure of the mutant i96s of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate

PDB Compounds: (B:) orotidine 5'-monophosphate decarboxylase

SCOPe Domain Sequences for d3pbub_:

Sequence; same for both SEQRES and ATOM records:

>d3pbub_ c.1.2.3 (B:) automated matches {Methanobacterium thermoautotrophicum [TaxId: 187420]}
vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
iadfkvadipetnekicratfkagadaisvhgfpgadsvraclnvaeemgrevflltems
hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqgg
dpgetlrfadaiivgrsiyladnpaaaaagiiesikdll

Timeline for d3pbub_:

• d3pbub_ first appeared in SCOPe 2.02
  
• d3pbub_ appears in SCOPe 2.05
  
• d3pbub_ appears in SCOPe 2.07
  
• d3pbub_ appears in the current release, SCOPe 2.08