SCOPe 2.08: Domain d3q3xb1: 3q3x B:1-180

Lineage for d3q3xb1 (3q3x B:1-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein 3C cysteine protease (picornain 3C) [50604] (9 species)

7. Species Human enterovirus b [TaxId:138949] [189732] (3 PDB entries)

8. Domain d3q3xb1: 3q3x B:1-180 [192798]
   Other proteins in same PDB: d3q3xa2, d3q3xb2
   automated match to d2vb0a_
   complexed with gol, mg

Details for d3q3xb1

PDB Entry: 3q3x, 1.9 Å

PDB Description: Crystal structure of the main protease (3C) from human enterovirus B EV93

PDB Compounds: (B:) HEVB EV93 3C protease

SCOPe Domain Sequences for d3q3xb1:

Sequence; same for both SEQRES and ATOM records:

>d3q3xb1 b.47.1.4 (B:1-180) 3C cysteine protease (picornain 3C) {Human enterovirus b [TaxId: 138949]}
gpafefavammkrnastvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflareevevneavlaintskfpnmyipvgqvt
dygflnlggtptkrmlvynfptragqcggvlmstgkvlgihvggnghqgfsaallrhyfn

Timeline for d3q3xb1:

• d3q3xb1 first appeared in SCOPe 2.02, called d3q3xb_
  
• d3q3xb1 appears in SCOPe 2.07