Lineage for d2y5ic_ (2y5i C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710348Protein automated matches [190132] (4 species)
    not a true protein
  7. 2710461Species Zebrafish (Danio rerio) [TaxId:7955] [189706] (1 PDB entry)
  8. 2710464Domain d2y5ic_: 2y5i C: [192789]
    automated match to d2k2fa1
    complexed with ca, ipa

Details for d2y5ic_

PDB Entry: 2y5i (more details), 2.03 Å

PDB Description: s100z from zebrafish in complex with calcium
PDB Compounds: (C:) s100 calcium binding protein z

SCOPe Domain Sequences for d2y5ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y5ic_ a.39.1.2 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
psklegamdalitvfhnysgsegdkyklskgelkellnaeltdflmsqkdpmlvekimnd
ldsnkdnevdfnefvvlvaaltvacndffqeqqkkrsk

SCOPe Domain Coordinates for d2y5ic_:

Click to download the PDB-style file with coordinates for d2y5ic_.
(The format of our PDB-style files is described here.)

Timeline for d2y5ic_: