SCOPe 2.02: Domain d2y5ib_: 2y5i B:

Lineage for d2y5ib_ (2y5i B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Danio rerio [TaxId:7955] [192785] (1 PDB entry)

8. Domain d2y5ib_: 2y5i B: [192788]
   automated match to d2k2fa1
   complexed with ca, ipa

Details for d2y5ib_

PDB Entry: 2y5i, 2.03 Å

PDB Description: s100z from zebrafish in complex with calcium

PDB Compounds: (B:) s100 calcium binding protein z

SCOPe Domain Sequences for d2y5ib_:

Sequence; same for both SEQRES and ATOM records:

>d2y5ib_ a.39.1.2 (B:) automated matches {Danio rerio [TaxId: 7955]}
sklegamdalitvfhnysgsegdkyklskgelkellnaeltdflmsqkdpmlvekimndl
dsnkdnevdfnefvvlvaaltvacndffqeqqkkrs

Timeline for d2y5ib_:

• d2y5ib_ is new in SCOPe 2.02-stable
  
• d2y5ib_ appears in SCOPe 2.03
  
• d2y5ib_ appears in the current release, SCOPe 2.08