![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
![]() | Protein automated matches [190132] (4 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [189706] (1 PDB entry) |
![]() | Domain d2y5ib_: 2y5i B: [192788] automated match to d2k2fa1 complexed with ca, ipa |
PDB Entry: 2y5i (more details), 2.03 Å
SCOPe Domain Sequences for d2y5ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y5ib_ a.39.1.2 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} sklegamdalitvfhnysgsegdkyklskgelkellnaeltdflmsqkdpmlvekimndl dsnkdnevdfnefvvlvaaltvacndffqeqqkkrs
Timeline for d2y5ib_: