Lineage for d3r8bp_ (3r8b P:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758768Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (7 PDB entries)
  8. 1758783Domain d3r8bp_: 3r8b P: [192781]
    Other proteins in same PDB: d3r8ba1, d3r8ba2, d3r8bc1, d3r8bc2, d3r8be1, d3r8be2, d3r8bg1, d3r8bg2, d3r8bi1, d3r8bi2, d3r8bk1, d3r8bk2, d3r8bm1, d3r8bm2, d3r8bo1, d3r8bo2
    automated match to d2apfa_
    complexed with cl, so4, zn

Details for d3r8bp_

PDB Entry: 3r8b (more details), 2.95 Å

PDB Description: Crystal structure of Staphylococcal Enterotoxin B in complex with an affinity matured mouse TCR VBeta8.2 protein, G5-8
PDB Compounds: (P:) g5-8

SCOPe Domain Sequences for d3r8bp_:

Sequence, based on SEQRES records: (download)

>d3r8bp_ b.1.1.1 (P:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd
ipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvly

Sequence, based on observed residues (ATOM records): (download)

>d3r8bp_ b.1.1.1 (P:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd
ipdgykasrpsqenfslilelatpsqtsvyfcasgggtlyfgagtrlsvly

SCOPe Domain Coordinates for d3r8bp_:

Click to download the PDB-style file with coordinates for d3r8bp_.
(The format of our PDB-style files is described here.)

Timeline for d3r8bp_: