![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48511] (38 PDB entries) Uniprot P19793 227-458 |
![]() | Domain d1fm6u_: 1fm6 U: [19278] Other proteins in same PDB: d1fm6d_, d1fm6x_ complexed with 9cr, brl |
PDB Entry: 1fm6 (more details), 2.1 Å
SCOPe Domain Sequences for d1fm6u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fm6u_ a.123.1.1 (U:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
Timeline for d1fm6u_: