![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (25 PDB entries) |
![]() | Domain d3r8bn_: 3r8b N: [192779] Other proteins in same PDB: d3r8ba1, d3r8ba2, d3r8bc1, d3r8bc2, d3r8be1, d3r8be2, d3r8bg1, d3r8bg2, d3r8bi1, d3r8bi2, d3r8bk1, d3r8bk2, d3r8bm1, d3r8bm2, d3r8bo1, d3r8bo2 automated match to d2apfa_ complexed with cl, so4, zn |
PDB Entry: 3r8b (more details), 2.95 Å
SCOPe Domain Sequences for d3r8bn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r8bn_ b.1.1.1 (N:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd ipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvly
Timeline for d3r8bn_: