SCOPe 2.05: Domain d1fm6a_: 1fm6 A:

Lineage for d1fm6a_ (1fm6 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48511] (34 PDB entries)
   Uniprot P19793 227-458

8. Domain d1fm6a_: 1fm6 A: [19277]
   Other proteins in same PDB: d1fm6d_, d1fm6x_
   complexed with 9cr, brl

Details for d1fm6a_

PDB Entry: 1fm6, 2.1 Å

PDB Description: the 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and rosiglitazone and co-activator peptides.

PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1fm6a_:

Sequence; same for both SEQRES and ATOM records:

>d1fm6a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Timeline for d1fm6a_:

• d1fm6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fm6a_ appears in SCOPe 2.04
  
• d1fm6a_ appears in SCOPe 2.06
  
• d1fm6a_ appears in the current release, SCOPe 2.08