SCOPe 2.04: Domain d3owec_: 3owe C:

Lineage for d3owec_ (3owe C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)

8. Domain d3owec_: 3owe C: [192766]
   Other proteins in same PDB: d3oweb1, d3oweb2, d3owed1, d3owed2, d3owef1, d3owef2, d3oweh1, d3oweh2, d3owej1, d3owej2, d3owel1, d3owel2, d3owen1, d3owen2, d3owep1, d3owep2
   automated match to d2apba_
   mutant

Details for d3owec_

PDB Entry: 3owe, 2.6 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain

PDB Compounds: (C:) Beta-chain

SCOPe Domain Sequences for d3owec_:

Sequence; same for both SEQRES and ATOM records:

>d3owec_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl

Timeline for d3owec_:

• d3owec_ first appeared in SCOPe 2.02
  
• d3owec_ appears in SCOPe 2.03
  
• d3owec_ appears in SCOPe 2.05
  
• d3owec_ appears in the current release, SCOPe 2.08