| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
| Protein Enoyl-ACP reductase [51791] (11 species) |
| Species Bacillus cereus [TaxId:226900] [192761] (6 PDB entries) |
| Domain d3ojfb1: 3ojf B:2-256 [192764] Other proteins in same PDB: d3ojfa2, d3ojfb2, d3ojfc2, d3ojfd1, d3ojfd2 automated match to d2qiod_ complexed with imj, ndp |
PDB Entry: 3ojf (more details), 2.2 Å
SCOPe Domain Sequences for d3ojfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ojfb1 c.2.1.2 (B:2-256) Enoyl-ACP reductase {Bacillus cereus [TaxId: 226900]}
ellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqesl
vlpcdvtndeeltacfetikqevgtihgvahciafanrddlkgefvdtsrdgfllaqnis
afsltavareakkvmteggniltltylggervvknynvmgvakasleasvkylandlgqh
girvnaisagpirtlsakgvgdfnsilreieeraplrrtttqeevgdtavflfsdlargv
tgenihvdsgyhilg
Timeline for d3ojfb1: