![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
![]() | Protein automated matches [190826] (23 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries) |
![]() | Domain d2x36b_: 2x36 B: [192758] automated match to d1xhkb_ |
PDB Entry: 2x36 (more details), 2 Å
SCOPe Domain Sequences for d2x36b_:
Sequence, based on SEQRES records: (download)
>d2x36b_ d.14.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mydvtppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmkesar iaytfaraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrq nlamtgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhf vehyreifdiafp
>d2x36b_ d.14.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mydvtppgvvmglawtamggstlfvetslgslevtgqlgevmkesariaytfaraflmqh apandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamtgevsltgk ilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyreifdiafp
Timeline for d2x36b_: