| Class b: All beta proteins [48724] (180 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.1: TNF-like [49843] (15 proteins) |
| Protein Complement c1q globular head, A chain [101613] (1 species) hetrotrimer of A, B and C chains |
| Species Human (Homo sapiens) [TaxId:9606] [101614] (6 PDB entries) |
| Domain d2wnvd_: 2wnv D: [192752] Other proteins in same PDB: d2wnvb_, d2wnvc_, d2wnve_, d2wnvf_ automated match to d1pk6a_ complexed with 2dr, ca, nag |
PDB Entry: 2wnv (more details), 1.25 Å
SCOPe Domain Sequences for d2wnvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wnvd_ b.22.1.1 (D:) Complement c1q globular head, A chain {Human (Homo sapiens) [TaxId: 9606]}
qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
adsvfsgflifpsa
Timeline for d2wnvd_: