Lineage for d2wnud_ (2wnu D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777219Protein Complement c1q globular head, A chain [101613] (1 species)
    hetrotrimer of A, B and C chains
  7. 2777220Species Human (Homo sapiens) [TaxId:9606] [101614] (6 PDB entries)
  8. 2777231Domain d2wnud_: 2wnu D: [192750]
    Other proteins in same PDB: d2wnub_, d2wnuc_, d2wnue_, d2wnuf_
    automated match to d1pk6a_
    complexed with nag

Details for d2wnud_

PDB Entry: 2wnu (more details), 2.3 Å

PDB Description: complex between c1q globular heads and heparan sulfate
PDB Compounds: (D:) complement c1q subcomponent subunit a

SCOPe Domain Sequences for d2wnud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnud_ b.22.1.1 (D:) Complement c1q globular head, A chain {Human (Homo sapiens) [TaxId: 9606]}
qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
adsvfsgflifps

SCOPe Domain Coordinates for d2wnud_:

Click to download the PDB-style file with coordinates for d2wnud_.
(The format of our PDB-style files is described here.)

Timeline for d2wnud_: