SCOPe 2.08: Domain d3a6he_: 3a6h E:

Lineage for d3a6he_ (3a6h E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.125: Creatininase [102214] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.125.1: Creatininase [102215] (1 family)
   automatically mapped to Pfam PF02633

5. Family c.125.1.1: Creatininase [102216] (2 proteins)

6. Protein automated matches [192735] (1 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [192736] (1 PDB entry)

8. Domain d3a6he_: 3a6h E: [192741]
   Other proteins in same PDB: d3a6hd_
   automated match to d1q3ka_
   complexed with cl, mn, zn; mutant

Details for d3a6he_

PDB Entry: 3a6h, 2 Å

PDB Description: w154a mutant creatininase

PDB Compounds: (E:) creatinine amidohydrolase

SCOPe Domain Sequences for d3a6he_:

Sequence; same for both SEQRES and ATOM records:

>d3a6he_ c.125.1.1 (E:) automated matches {Pseudomonas putida [TaxId: 303]}
svfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaerigal
vmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghyen
smfivegidlalrelryagiqdfkvvvlsyadfvkdpaviqqlypegflgwdiehggvfe
tslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelile
vcvqgiadaireefpp

Timeline for d3a6he_:

• d3a6he_ first appeared in SCOPe 2.02
  
• d3a6he_ appears in SCOPe 2.07