Lineage for d3a6hb_ (3a6h B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169844Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2169845Superfamily c.125.1: Creatininase [102215] (1 family) (S)
    automatically mapped to Pfam PF02633
  5. 2169846Family c.125.1.1: Creatininase [102216] (2 proteins)
  6. 2169916Protein automated matches [192735] (1 species)
    not a true protein
  7. 2169917Species Pseudomonas putida [TaxId:303] [192736] (1 PDB entry)
  8. 2169919Domain d3a6hb_: 3a6h B: [192740]
    Other proteins in same PDB: d3a6hd_
    automated match to d1q3ka_
    complexed with cl, mn, zn; mutant

Details for d3a6hb_

PDB Entry: 3a6h (more details), 2 Å

PDB Description: w154a mutant creatininase
PDB Compounds: (B:) creatinine amidohydrolase

SCOPe Domain Sequences for d3a6hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6hb_ c.125.1.1 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
svfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaerigal
vmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghyen
smfivegidlalrelryagiqdfkvvvlsyadfvkdpaviqqlypegflgwdiehggvfe
tslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelile
vcvqgiadaireefpp

SCOPe Domain Coordinates for d3a6hb_:

Click to download the PDB-style file with coordinates for d3a6hb_.
(The format of our PDB-style files is described here.)

Timeline for d3a6hb_: