SCOPe 2.01: Domain d1fm9a_: 1fm9 A:

Lineage for d1fm9a_ (1fm9 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48511] (32 PDB entries)
   Uniprot P19793 227-458

8. Domain d1fm9a_: 1fm9 A: [19274]
   Other proteins in same PDB: d1fm9d_
   complexed with 570, rea

Details for d1fm9a_

PDB Entry: 1fm9, 2.1 Å

PDB Description: the 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and gi262570 and co-activator peptides.

PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1fm9a_:

Sequence; same for both SEQRES and ATOM records:

>d1fm9a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Timeline for d1fm9a_:

• d1fm9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fm9a_ appears in SCOP 1.75
  
• d1fm9a_ appears in SCOPe 2.02
  
• d1fm9a_ appears in the current release, SCOPe 2.08