Lineage for d1fm9a_ (1fm9 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360318Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 360319Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 360320Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (27 proteins)
  6. 360510Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 360511Species Human (Homo sapiens) [TaxId:9606] [48511] (10 PDB entries)
  8. 360522Domain d1fm9a_: 1fm9 A: [19274]
    Other proteins in same PDB: d1fm9d_
    complexed with 570, rea

Details for d1fm9a_

PDB Entry: 1fm9 (more details), 2.1 Å

PDB Description: the 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and gi262570 and co-activator peptides.

SCOP Domain Sequences for d1fm9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fm9a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens)}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

SCOP Domain Coordinates for d1fm9a_:

Click to download the PDB-style file with coordinates for d1fm9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fm9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fm9d_