| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.125: Creatininase [102214] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.125.1: Creatininase [102215] (1 family) ![]() automatically mapped to Pfam PF02633 |
| Family c.125.1.1: Creatininase [102216] (2 proteins) |
| Protein automated matches [192735] (1 species) not a true protein |
| Species Pseudomonas putida [TaxId:303] [192736] (1 PDB entry) |
| Domain d3a6hc_: 3a6h C: [192739] Other proteins in same PDB: d3a6hd_ automated match to d1q3ka_ complexed with cl, mn, zn; mutant |
PDB Entry: 3a6h (more details), 2 Å
SCOPe Domain Sequences for d3a6hc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a6hc_ c.125.1.1 (C:) automated matches {Pseudomonas putida [TaxId: 303]}
svfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaerigal
vmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghyen
smfivegidlalrelryagiqdfkvvvlsyadfvkdpaviqqlypegflgwdiehggvfe
tslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelile
vcvqgiadaireefpp
Timeline for d3a6hc_: