Lineage for d3a6hf_ (3a6h F:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1189314Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1189315Superfamily c.125.1: Creatininase [102215] (1 family) (S)
  5. 1189316Family c.125.1.1: Creatininase [102216] (2 proteins)
  6. 1189386Protein automated matches [192735] (1 species)
    not a true protein
  7. 1189387Species Pseudomonas putida [TaxId:303] [192736] (1 PDB entry)
  8. 1189392Domain d3a6hf_: 3a6h F: [192738]
    Other proteins in same PDB: d3a6hd_
    automated match to d1q3ka_
    complexed with cl, mn, zn; mutant

Details for d3a6hf_

PDB Entry: 3a6h (more details), 2 Å

PDB Description: w154a mutant creatininase
PDB Compounds: (F:) creatinine amidohydrolase

SCOPe Domain Sequences for d3a6hf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6hf_ c.125.1.1 (F:) automated matches {Pseudomonas putida [TaxId: 303]}
ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
nsmfivegidlalrelryagiqdfkvvvlsyadfvkdpaviqqlypegflgwdiehggvf
etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
evcvqgiadaireefpp

SCOPe Domain Coordinates for d3a6hf_:

Click to download the PDB-style file with coordinates for d3a6hf_.
(The format of our PDB-style files is described here.)

Timeline for d3a6hf_: