Lineage for d3k8bd_ (3k8b D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2302284Species Turkey (Meleagris gallopavo) [TaxId:9103] [189160] (4 PDB entries)
  8. 2302296Domain d3k8bd_: 3k8b D: [192733]
    automated match to d2qmbd_
    complexed with hem

Details for d3k8bd_

PDB Entry: 3k8b (more details), 2.3 Å

PDB Description: Crystal structure of Turkey (Meleagiris gallopova)hemoglobin at 2.3 Angstrom
PDB Compounds: (D:) hemoglobin beta chain

SCOPe Domain Sequences for d3k8bd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k8bd_ a.1.1.2 (D:) automated matches {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffasfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahfsk
dftpecqaawqklvrvvahalarkyh

SCOPe Domain Coordinates for d3k8bd_:

Click to download the PDB-style file with coordinates for d3k8bd_.
(The format of our PDB-style files is described here.)

Timeline for d3k8bd_: