Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (44 species) not a true protein |
Species Turkey (Meleagris gallopavo) [TaxId:9103] [189160] (4 PDB entries) |
Domain d3k8bc_: 3k8b C: [192732] automated match to d2qmba_ complexed with hem |
PDB Entry: 3k8b (more details), 2.3 Å
SCOPe Domain Sequences for d3k8bc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k8bc_ a.1.1.2 (C:) automated matches {Turkey (Meleagris gallopavo) [TaxId: 9103]} vlsaadknnvkgiftkiaghaeeygaetlermfitypptktyfphfdlshgsaqikghgk kvvaalieaanhiddiagtlsklsdlhahklrvdpvnfkllgqcflvvvaihhpaaltpe vhasldkflcavgtvltakyr
Timeline for d3k8bc_: