| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
| Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
| Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries) |
| Domain d1fs2d1: 1fs2 D:80-146 [19273] Other proteins in same PDB: d1fs2a1, d1fs2a2, d1fs2b2, d1fs2c1, d1fs2c2, d1fs2d2 |
PDB Entry: 1fs2 (more details), 2.9 Å
SCOPe Domain Sequences for d1fs2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs2d1 a.157.1.1 (D:80-146) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
krtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktf
nikndft
Timeline for d1fs2d1: