SCOPe 2.04: Domain d3bbce_: 3bbc E:

Lineage for d3bbce_ (3bbc E:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54922] (5 PDB entries)

8. Domain d3bbce_: 3bbc E: [192711]
   automated match to d3bbcd_
   mutant

Details for d3bbce_

PDB Entry: 3bbc, 1.7 Å

PDB Description: crystal structure of r88a mutant of the nm23-h2 transcription factor

PDB Compounds: (E:) Nucleoside diphosphate kinase B

SCOPe Domain Sequences for d3bbce_:

Sequence; same for both SEQRES and ATOM records:

>d3bbce_ d.58.6.1 (E:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgavmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvye

Timeline for d3bbce_:

• d3bbce_ first appeared in SCOPe 2.02
  
• d3bbce_ appears in SCOPe 2.03
  
• d3bbce_ appears in SCOPe 2.05
  
• d3bbce_ appears in the current release, SCOPe 2.08