SCOP 1.61: Domain d1fs2c1: 1fs2 C:105-145

Lineage for d1fs2c1 (1fs2 C:105-145)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.122: Skp1-Skp2 dimerisation domains [48502] (1 superfamily)

4. Superfamily a.122.1: Skp1-Skp2 dimerisation domains [48503] (1 family)

5. Family a.122.1.1: Skp1-Skp2 dimerisation domains [48504] (1 protein)

6. Protein Skp1-Skp2 dimerisation domains [48505] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48506] (4 PDB entries)

8. Domain d1fs2c1: 1fs2 C:105-145 [19271]
   Other proteins in same PDB: d1fs2a2, d1fs2b2, d1fs2c2, d1fs2d2

Details for d1fs2c1

PDB Entry: 1fs2, 2.9 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs2c1:

Sequence; same for both SEQRES and ATOM records:

>d1fs2c1 a.122.1.1 (C:105-145) Skp1-Skp2 dimerisation domains {Human (Homo sapiens)}
pgvswdslpdelllgifsclclpellkvsgvckrwyrlasd

Timeline for d1fs2c1:

• d1fs2c1 first appeared (with stable ids) in SCOP 1.55
  
• d1fs2c1 appears in SCOP 1.59
  
• d1fs2c1 appears in SCOP 1.63
  
• d1fs2c1 appears in the current release, SCOPe 2.08