Lineage for d3bbcc_ (3bbc C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951127Species Human (Homo sapiens) [TaxId:9606] [54922] (5 PDB entries)
  8. 2951136Domain d3bbcc_: 3bbc C: [192709]
    automated match to d3bbcd_
    mutant

Details for d3bbcc_

PDB Entry: 3bbc (more details), 1.7 Å

PDB Description: crystal structure of r88a mutant of the nm23-h2 transcription factor
PDB Compounds: (C:) Nucleoside diphosphate kinase B

SCOPe Domain Sequences for d3bbcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbcc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgavmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvye

SCOPe Domain Coordinates for d3bbcc_:

Click to download the PDB-style file with coordinates for d3bbcc_.
(The format of our PDB-style files is described here.)

Timeline for d3bbcc_: