![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
![]() | Superfamily a.158.1: F-box domain [81383] (1 family) ![]() |
![]() | Family a.158.1.1: F-box domain [81381] (3 proteins) |
![]() | Protein Skp2 [81379] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81377] (4 PDB entries) |
![]() | Domain d1fs2a1: 1fs2 A:105-145 [19270] Other proteins in same PDB: d1fs2a2, d1fs2b1, d1fs2b2, d1fs2c2, d1fs2d1, d1fs2d2 |
PDB Entry: 1fs2 (more details), 2.9 Å
SCOP Domain Sequences for d1fs2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs2a1 a.158.1.1 (A:105-145) Skp2 {Human (Homo sapiens)} pgvswdslpdelllgifsclclpellkvsgvckrwyrlasd
Timeline for d1fs2a1: