SCOPe 2.04: Domain d2qmbb_: 2qmb B:

Lineage for d2qmbb_ (2qmb B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (38 species)
   not a true protein

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [189160] (2 PDB entries)

8. Domain d2qmbb_: 2qmb B: [192698]
   automated match to d2qmbd_
   complexed with hem, oxy

Details for d2qmbb_

PDB Entry: 2qmb, 2.8 Å

PDB Description: structure determination of haemoglobin from turkey(meleagris gallopavo) at 2.8 angstrom resolution

PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d2qmbb_:

Sequence; same for both SEQRES and ATOM records:

>d2qmbb_ a.1.1.2 (B:) automated matches {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffasfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahfsk
dftpecqaawqklvrvvahalarkyh

Timeline for d2qmbb_:

• d2qmbb_ first appeared in SCOPe 2.02
  
• d2qmbb_ appears in SCOPe 2.03
  
• d2qmbb_ appears in SCOPe 2.05
  
• d2qmbb_ appears in the current release, SCOPe 2.08