| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
| Protein automated matches [190085] (59 species) not a true protein |
| Species Bacillus anthracis [TaxId:198094] [188031] (1 PDB entry) |
| Domain d2uvdb_: 2uvd B: [192692] automated match to d2uvdd_ |
PDB Entry: 2uvd (more details), 2.4 Å
SCOPe Domain Sequences for d2uvdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uvdb_ c.2.1.2 (B:) automated matches {Bacillus anthracis [TaxId: 198094]}
mlkgkvalvtgasrgigraiaidlakqganvvvnyagneqkanevvdeikklgsdaiavr
advanaedvtnmvkqtvdvfgqvdilvnnagvtkdnllmrmkeeewdtvintnlkgvflc
tkavsrfmmrqrhgrivniasvvgvtgnpgqanyvaakagvigltktsakelasrnitvn
aiapgfiatdmtdvldenikaemlklipaaqfgeaqdianavtffasdqskyitgqtlnv
dggmvm
Timeline for d2uvdb_: