SCOPe 2.02: Domain d2uvdf_: 2uvd F:

Lineage for d2uvdf_ (2uvd F:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein automated matches [190085] (34 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [188031] (1 PDB entry)

8. Domain d2uvdf_: 2uvd F: [192689]
   automated match to d2uvdd_

Details for d2uvdf_

PDB Entry: 2uvd, 2.4 Å

PDB Description: the crystal structure of a 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis (ba3989)

PDB Compounds: (F:) 3-oxoacyl-(acyl-carrier-protein) reductase

SCOPe Domain Sequences for d2uvdf_:

Sequence; same for both SEQRES and ATOM records:

>d2uvdf_ c.2.1.2 (F:) automated matches {Bacillus anthracis [TaxId: 198094]}
mlkgkvalvtgasrgigraiaidlakqganvvvnyagneqkanevvdeikklgsdaiavr
advanaedvtnmvkqtvdvfgqvdilvnnagvtkdnllmrmkeeewdtvintnlkgvflc
tkavsrfmmrqrhgrivniasvvgvtgnpgqanyvaakagvigltktsakelasrnitvn
aiapgfiatdmtdvldenikaemlklipaaqfgeaqdianavtffasdqskyitgqtlnv
dggmvm

Timeline for d2uvdf_:

• d2uvdf_ is new in SCOPe 2.02-stable
  
• d2uvdf_ appears in SCOPe 2.03
  
• d2uvdf_ appears in the current release, SCOPe 2.08