SCOPe 2.06: Domain d2chpb_: 2chp B:

Lineage for d2chpb_ (2chp B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (39 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187547] (2 PDB entries)

8. Domain d2chpb_: 2chp B: [192687]
   automated match to d1ji5a_
   complexed with po4

Details for d2chpb_

PDB Entry: 2chp, 2 Å

PDB Description: crystal structure of the dodecameric ferritin mrga from b. subtilis 168

PDB Compounds: (B:) metalloregulation DNA-binding stress protein

SCOPe Domain Sequences for d2chpb_:

Sequence; same for both SEQRES and ATOM records:

>d2chpb_ a.25.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
ktnqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaetvdtiae
rllaiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfviglaeenq
dnatadlfvglieevekqvwmlssylg

Timeline for d2chpb_:

• d2chpb_ first appeared in SCOPe 2.02
  
• d2chpb_ appears in SCOPe 2.05
  
• d2chpb_ appears in SCOPe 2.07
  
• d2chpb_ appears in the current release, SCOPe 2.08