Lineage for d2chpb_ (2chp B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314636Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2314637Protein automated matches [190036] (45 species)
    not a true protein
  7. 2314696Species Bacillus subtilis [TaxId:1423] [187547] (2 PDB entries)
  8. 2314700Domain d2chpb_: 2chp B: [192687]
    automated match to d1ji5a_
    complexed with po4

Details for d2chpb_

PDB Entry: 2chp (more details), 2 Å

PDB Description: crystal structure of the dodecameric ferritin mrga from b. subtilis 168
PDB Compounds: (B:) metalloregulation DNA-binding stress protein

SCOPe Domain Sequences for d2chpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2chpb_ a.25.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
ktnqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaetvdtiae
rllaiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfviglaeenq
dnatadlfvglieevekqvwmlssylg

SCOPe Domain Coordinates for d2chpb_:

Click to download the PDB-style file with coordinates for d2chpb_.
(The format of our PDB-style files is described here.)

Timeline for d2chpb_: