Lineage for d4j70u_ (4j70 U:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2228445Domain d4j70u_: 4j70 U: [192683]
    Other proteins in same PDB: d4j70a_, d4j70e_, d4j70f_, d4j70i_, d4j70j_, d4j70k_, d4j70l_, d4j70m_, d4j70n_, d4j70o_, d4j70s_, d4j70t_, d4j70w_, d4j70x_, d4j70y_, d4j70z_
    automated match to d1rypa_
    complexed with 1kr

Details for d4j70u_

PDB Entry: 4j70 (more details), 2.8 Å

PDB Description: Yeast 20S proteasome in complex with the belactosin derivative 3e
PDB Compounds: (U:) Proteasome component C7-alpha

SCOPe Domain Sequences for d4j70u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j70u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d4j70u_:

Click to download the PDB-style file with coordinates for d4j70u_.
(The format of our PDB-style files is described here.)

Timeline for d4j70u_: