| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.5: F17c-type adhesin [89215] (3 proteins) automatically mapped to Pfam PF09222 |
| Protein automated matches [190525] (1 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187483] (6 PDB entries) |
| Domain d4k0oa_: 4k0o A: [192681] automated match to d3ffoa_ complexed with ni, so4 |
PDB Entry: 4k0o (more details), 2.15 Å
SCOPe Domain Sequences for d4k0oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k0oa_ b.2.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnylstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlnd
Timeline for d4k0oa_: