SCOPe 2.06: Domain d4avea_: 4ave A:

Lineage for d4avea_ (4ave A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins)
   lack the first helix but otherwise is more similar to conventional globins than the truncated ones
   automatically mapped to Pfam PF00042

6. Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species)

7. Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [74662] (13 PDB entries)
   Uniprot O76242

8. Domain d4avea_: 4ave A: [192677]
   automated match to d2xkia_
   complexed with act, gol, hem, so4

Details for d4avea_

PDB Entry: 4ave, 1.9 Å

PDB Description: c.lacteus nerve hb in the deoxy form

PDB Compounds: (A:) neural hemoglobin

SCOPe Domain Sequences for d4avea_:

Sequence; same for both SEQRES and ATOM records:

>d4avea_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl

Timeline for d4avea_:

• d4avea_ first appeared in SCOPe 2.02
  
• d4avea_ appears in SCOPe 2.05
  
• d4avea_ appears in SCOPe 2.07
  
• d4avea_ appears in the current release, SCOPe 2.08