SCOPe 2.05: Domain d4hpaa_: 4hpa A:

Lineage for d4hpaa_ (4hpa A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 4 [50845] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50846] (44 PDB entries)
   Uniprot Q94734 22-205

8. Domain d4hpaa_: 4hpa A: [192660]
   automated match to d1x8qa_
   complexed with h2s, hem

Details for d4hpaa_

PDB Entry: 4hpa, 1.5 Å

PDB Description: Crystal structure of Nitrophorin 4 from Rhodnius prolixus Complexed with sulfide ion at pH 7.4

PDB Compounds: (A:) Nitrophorin-4

SCOPe Domain Sequences for d4hpaa_:

Sequence; same for both SEQRES and ATOM records:

>d4hpaa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

Timeline for d4hpaa_:

• d4hpaa_ first appeared in SCOPe 2.02
  
• d4hpaa_ appears in SCOPe 2.04
  
• d4hpaa_ appears in SCOPe 2.06
  
• d4hpaa_ appears in the current release, SCOPe 2.08