Lineage for d4il6l_ (4il6 L:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238771Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
  5. 1238772Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 1238773Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 1238776Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (1 PDB entry)
  8. 1238777Domain d4il6l_: 4il6 L: [192656]
    automated match to d2axtl1
    complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl

Details for d4il6l_

PDB Entry: 4il6 (more details), 2.1 Å

PDB Description: structure of sr-substituted photosystem ii
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d4il6l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il6l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d4il6l_:

Click to download the PDB-style file with coordinates for d4il6l_.
(The format of our PDB-style files is described here.)

Timeline for d4il6l_: