Lineage for d4fa4e_ (4fa4 E:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261162Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2261163Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2261164Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 2261165Protein Methylamine dehydrogenase [57563] (2 species)
  7. 2261166Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)
  8. 2261194Domain d4fa4e_: 4fa4 E: [192649]
    Other proteins in same PDB: d4fa4c2
    automated match to d2bbkl_
    complexed with act, ca, edo, hec, na, pge, po4

Details for d4fa4e_

PDB Entry: 4fa4 (more details), 2.14 Å

PDB Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 10 Days
PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d4fa4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fa4e_ g.21.1.1 (E:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
gtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynpt
dgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctisp
ivgkas

SCOPe Domain Coordinates for d4fa4e_:

Click to download the PDB-style file with coordinates for d4fa4e_.
(The format of our PDB-style files is described here.)

Timeline for d4fa4e_: