Lineage for d4alca_ (4alc A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771151Species Enterococcus faecalis [TaxId:1351] [189861] (7 PDB entries)
  8. 1771157Domain d4alca_: 4alc A: [192643]
    automated match to d4a02a_
    complexed with cu, peg

Details for d4alca_

PDB Entry: 4alc (more details), 1.49 Å

PDB Description: x-ray photoreduction of polysaccharide monooxigenase cbm33
PDB Compounds: (A:) chitin binding protein

SCOPe Domain Sequences for d4alca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4alca_ b.1.18.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
hgyvaspgsraffgssaggnlntnvgraqwepqsieapkntfitgklasagvsgfeplde
qtatrwhktnittgplditwnltaqhrtaswdyyitkngwnpnqpldiknfdkiasidgk
qevpnkvvkqtiniptdrkgyhviyavwgigdtvnafyqaidvniq

SCOPe Domain Coordinates for d4alca_:

Click to download the PDB-style file with coordinates for d4alca_.
(The format of our PDB-style files is described here.)

Timeline for d4alca_: