![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:1351] [189861] (7 PDB entries) |
![]() | Domain d4alqa_: 4alq A: [192642] automated match to d4a02a_ complexed with cu, peg |
PDB Entry: 4alq (more details), 1.48 Å
SCOPe Domain Sequences for d4alqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4alqa_ b.1.18.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]} hgyvaspgsraffgssaggnlntnvgraqwepqsieapkntfitgklasagvsgfeplde qtatrwhktnittgplditwnltaqhrtaswdyyitkngwnpnqpldiknfdkiasidgk qevpnkvvkqtiniptdrkgyhviyavwgigdtvnafyqaidvniq
Timeline for d4alqa_: