Lineage for d4alta_ (4alt A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376117Species Enterococcus faecalis [TaxId:1351] [189861] (7 PDB entries)
  8. 2376122Domain d4alta_: 4alt A: [192641]
    automated match to d4a02a_
    complexed with cu, peg

Details for d4alta_

PDB Entry: 4alt (more details), 1.49 Å

PDB Description: x-ray photoreduction of polysaccharide monooxygenase cbm33
PDB Compounds: (A:) chitin binding protein

SCOPe Domain Sequences for d4alta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4alta_ b.1.18.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
hgyvaspgsraffgssaggnlntnvgraqwepqsieapkntfitgklasagvsgfeplde
qtatrwhktnittgplditwnltaqhrtaswdyyitkngwnpnqpldiknfdkiasidgk
qevpnkvvkqtiniptdrkgyhviyavwgigdtvnafyqaidvniq

SCOPe Domain Coordinates for d4alta_:

Click to download the PDB-style file with coordinates for d4alta_.
(The format of our PDB-style files is described here.)

Timeline for d4alta_: