| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
| Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
| Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries) |
| Domain d1fqvb1: 1fqv B:85-160 [19262] Other proteins in same PDB: d1fqva1, d1fqva2, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd2, d1fqve1, d1fqve2, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp2 |
PDB Entry: 1fqv (more details), 2.8 Å
SCOPe Domain Sequences for d1fqvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqvb1 a.157.1.1 (B:85-160) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqwc
Timeline for d1fqvb1:
View in 3DDomains from other chains: (mouse over for more information) d1fqva1, d1fqva2, d1fqvc1, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve1, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp1, d1fqvp2 |