Lineage for d4ar4a_ (4ar4 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036509Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 3036518Protein Rubredoxin [57804] (8 species)
  7. 3036583Species Pyrococcus furiosus [TaxId:2261] [57809] (30 PDB entries)
    Uniprot P24297
  8. 3036607Domain d4ar4a_: 4ar4 A: [192592]
    automated match to d3kyua_
    complexed with d3o, d8u, dod, fe

Details for d4ar4a_

PDB Entry: 4ar4 (more details), 1.38 Å

PDB Description: neutron crystallographic structure of the reduced form perdeuterated pyrococcus furiosus rubredoxin to 1.38 angstrom resolution.
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d4ar4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ar4a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

SCOPe Domain Coordinates for d4ar4a_:

Click to download the PDB-style file with coordinates for d4ar4a_.
(The format of our PDB-style files is described here.)

Timeline for d4ar4a_: