SCOP 1.57: Domain d1fqvk1: 1fqv K:107-145

Lineage for d1fqvk1 (1fqv K:107-145)

Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds)
Fold a.122: Skp1-Skp2 dimerisation domains [48502] (1 superfamily)
Superfamily a.122.1: Skp1-Skp2 dimerisation domains [48503] (1 family)
Family a.122.1.1: Skp1-Skp2 dimerisation domains [48504] (1 protein)
Protein Skp1-Skp2 dimerisation domains [48505] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [48506] (3 PDB entries)

Domain d1fqvk1: 1fqv K:107-145 [19259]
Other proteins in same PDB: d1fqva2, d1fqvb2, d1fqvc2, d1fqvd2, d1fqve2, d1fqvf2, d1fqvg2, d1fqvh2, d1fqvi2, d1fqvj2, d1fqvk2, d1fqvl2, d1fqvm2, d1fqvn2, d1fqvo2, d1fqvp2

Details for d1fqvk1

PDB Entry: 1fqv (more details), 2.8 Å

PDB Description: Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fqvk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqvk1 a.122.1.1 (K:107-145) Skp1-Skp2 dimerisation domains {Human (Homo sapiens)}
vswdslpdelllgifsclclpellkvsgvckrwyrlasd

SCOP Domain Coordinates for d1fqvk1:

Click to download the PDB-style file with coordinates for d1fqvk1.
(The format of our PDB-style files is described here.)

Timeline for d1fqvk1:

d1fqvk1 first appeared (with stable ids) in SCOP 1.55
d1fqvk1 appears in SCOP 1.59
d1fqvk1 appears in the current release, SCOPe 2.08

Thumbnails for d1fqvk1:

d1fqvk1
(click for larger image)

d1fqvk1 in context of chain

View in 3D
Domains from same chain:
(mouse over for more information)
d1fqvk2

d1fqvk1 in context of PDB

View in 3D
Domains from other chains:
(mouse over for more information)
d1fqva1, d1fqva2, d1fqvb1, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve1, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp1, d1fqvp2