SCOPe 2.02: Domain d3zeja_: 3zej A:

Lineage for d3zeja_ (3zej A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)

6. Protein Thaumatin [49876] (1 species)

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (47 PDB entries)
   Uniprot P02883

8. Domain d3zeja_: 3zej A: [192586]
   automated match to d1kwna_
   complexed with tla

Details for d3zeja_

PDB Entry: 3zej, 1.55 Å

PDB Description: thaumatin structure determined at room temperature by in-situ diffraction in chipx

PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d3zeja_:

Sequence; same for both SEQRES and ATOM records:

>d3zeja_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d3zeja_:

• d3zeja_ is new in SCOPe 2.02-stable
  
• d3zeja_ appears in SCOPe 2.03
  
• d3zeja_ appears in the current release, SCOPe 2.08