Lineage for d4huea_ (4hue A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1373756Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1373757Protein BH0863-like Ribonuclease H [142490] (3 species)
    new class of RNase H
  7. 1373758Species Bacillus halodurans [TaxId:86665] [142491] (19 PDB entries)
    Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
    BH0863
  8. 1373762Domain d4huea_: 4hue A: [192577]
    automated match to d1zbfa1
    protein/DNA complex; complexed with gol, mg

Details for d4huea_

PDB Entry: 4hue (more details), 1.56 Å

PDB Description: Structure of 5-chlorouracil modified G:U base pair
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d4huea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4huea_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgeikadyg

SCOPe Domain Coordinates for d4huea_:

Click to download the PDB-style file with coordinates for d4huea_.
(The format of our PDB-style files is described here.)

Timeline for d4huea_: