Lineage for d4hufa_ (4huf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2885834Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2885835Protein BH0863-like Ribonuclease H [142490] (3 species)
    new class of RNase H
  7. 2885836Species Bacillus halodurans [TaxId:86665] [142491] (21 PDB entries)
    Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
    BH0863
  8. 2885862Domain d4hufa_: 4huf A: [192576]
    automated match to d1zbfa1
    protein/DNA complex; complexed with edo, gol, mg

Details for d4hufa_

PDB Entry: 4huf (more details), 1.69 Å

PDB Description: structure of 5-chlorouracil modified a:u base pair
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d4hufa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hufa_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgeikadyg

SCOPe Domain Coordinates for d4hufa_:

Click to download the PDB-style file with coordinates for d4hufa_.
(The format of our PDB-style files is described here.)

Timeline for d4hufa_: